Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HOXB9, Mouse, Clone: 2E9, Abnova™

Catalog No. 89104673 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-673 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-673 Supplier Abnova Corporation Supplier No. H00003219M06A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant HOXB9.

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq

Sequence: PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG

Specifications

Antigen HOXB9
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant HOXB9.
Formulation ascites with no preservative
Gene HOXB9
Gene Accession No. NM_024017
Gene Alias HOX-2.5/HOX2/HOX2E
Gene Symbols HOXB9
Host Species Mouse
Immunogen HOXB9 (NP_076922.1,65 a.a. ∽ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3219
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.