HOXC5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-675	50 μL

Catalog No. 89-104-675 Supplier Abnova Corporation Supplier No. H00003222A01

Description

Mouse polyclonal antibody raised against a partial recombinant HOXC5.

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' noncoding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq]

Sequence: MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR

Specifications

• Antigen: HOXC5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HOXC5.
• Formulation: 50% glycerol
• Gene: HOXC5
• Gene Accession No.: NM_018953
• Gene Alias: CP11/HOX3/HOX3D
• Gene Symbols: HOXC5
• Host Species: Mouse
• Immunogen: HOXC5 (NP_061826.1, 1 a.a. ∽ 68 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3222
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only