HOXD8, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-678	50 μL

Catalog No. 89-104-678 Supplier Abnova Corporation Supplier No. H00003234A01

Description

Mouse polyclonal antibody raised against a partial recombinant HOXD8.

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. [provided by RefSeq]

Sequence: GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR

Specifications

• Antigen: HOXD8
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HOXD8.
• Formulation: 50% glycerol
• Gene: HOXD8
• Gene Accession No.: NM_019558
• Gene Alias: HOX4/HOX4E/HOX5.4
• Gene Symbols: HOXD8
• Host Species: Mouse
• Immunogen: HOXD8 (NP_062458, 126 a.a. ∽ 190 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3234
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only