HR, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-071	50 μL

Catalog No. 89-107-071 Supplier Abnova Corporation Supplier No. H00055806A01

Description

Mouse polyclonal antibody raised against a partial recombinant HR.

This gene encodes a protein that is involved in hair growth. This protein functions as a transcriptional corepressor of multiple nuclear receptors, including thyroid hormone receptor, the retinoic acid receptor-related orphan receptors and the vitamin D receptors, and it interacts with histone deacetylases. The translation of this protein is modulated by multiple regulatory ORFs that exist upstream of the primary ORF. Mutations in one of these upstream ORFs, U2HR, cause Marie Unna hereditary hypotrichosis (MUHH), an autosomal dominant form of genetic hair loss. Mutations in this gene also cause autosomal recessive congenital alopecia and atrichia with papular lesions, other diseases resulting in hair loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LDAGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTVSVTQHFLSPETSALSAQLCHQGPSLPPDCHLLYAQMDWAVFQAVKVAVGTLQEAK

Specifications

• Antigen: HR
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HR.
• Formulation: 50% glycerol
• Gene: HR
• Gene Accession No.: NM_005144
• Gene Alias: ALUNC/AU/HSA277165
• Gene Symbols: HR
• Host Species: Mouse
• Immunogen: HR (NP_005135, 1090 a.a. ∽ 1189 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55806
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only