HRAS (B02P), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-681	50 μg

Catalog No. 89-104-681 Supplier Abnova Corporation Supplier No. H00003265B02P

Description

Mouse polyclonal antibody raised against a full-length human HRAS protein.

This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq

Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

Specifications

• Antigen: HRAS
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human HRAS protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HRAS
• Gene Accession No.: BC095471.1
• Gene Alias: C-BAS/HAS/C-H-RAS/C-HA-RAS1/CTLO/H-RASIDX/HAMSV/HRAS1/K-RAS/N-RAS/RASH1
• Gene Symbols: HRAS
• Host Species: Mouse
• Immunogen: HRAS (AAH95471.1,1 a.a. ∽ 189 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3265
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG

For Research Use Only