HSPG2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-693	50 μL

Catalog No. 89-104-693 Supplier Abnova Corporation Supplier No. H00003339A01

Description

Mouse polyclonal antibody raised against a partial recombinant HSPG2.

Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM

Sequence: GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV

Specifications

• Antigen: HSPG2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant HSPG2.
• Formulation: 50% glycerol
• Gene: HSPG2
• Gene Accession No.: NM_005529
• Gene Alias: PLC/PRCAN/SJA/SJS/SJS1
• Gene Symbols: HSPG2
• Host Species: Mouse
• Immunogen: HSPG2 (NP_005520.3, 25 a.a. ∽ 134 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3339
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only