IFI16, Mouse, Clone: 2C2, Abnova™

Catalog No.	Quantity
89-104-715	200 μL

Catalog No. 89-104-715 Supplier Abnova Corporation Supplier No. H00003428M02A

Description

Mouse monoclonal antibody raised against a partial recombinant IFI16.

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. [provided by RefSeq

Sequence: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

Specifications

• Antigen: IFI16
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IFI16.
• Formulation: ascites with no preservative
• Gene: IFI16
• Gene Accession No.: BC017059
• Gene Alias: IFNGIP1/MGC9466/PYHIN2
• Gene Symbols: IFI16
• Host Species: Mouse
• Immunogen: IFI16 (AAH17059,630 a.a. ∽ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3428
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ