Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IGF2R, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant IGF2R.

Manufacturer:  Abnova Corporation H00003482A01

Catalog No. 89-104-728


Add to cart

Description

Description

The protein encoded by this gene is a receptor for both, insulin-like growth factor 2 (IGF2) and mannose 6-phosphate (M6P). The IGF2 and M6P binding sites are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of IGF2. In mice, the homologous gene is expressed only from the maternal chromosome. [provided by RefSeq

Sequence: GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRD
Specifications

Specifications

IGF2R
Unconjugated
50% glycerol
NM_000876
CD222/CIMPR/M6P-R/MPR1/MPRI
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA
Mouse polyclonal antibody raised against a partial recombinant IGF2R.
IGF2R
Antisera
IGF2R
IGF2R (NP_000867, 121 a.a. ∽ 220 a.a) partial recombinant protein with GST tag.
RUO
Primary
3482
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only