IL12RB2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-748	50 μL

Catalog No. 89-104-748 Supplier Abnova Corporation Supplier No. H00003595A01

Description

Mouse polyclonal antibody raised against a partial recombinant IL12RB2.

The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohn's disease and leprosy, which is thought to contribute to the inflammatory response and host defense. [provided by RefSeq]

Sequence: CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPS

Specifications

• Antigen: IL12RB2
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant IL12RB2.
• Formulation: 50% glycerol
• Gene: IL12RB2
• Gene Accession No.: NM_001559
• Gene Symbols: IL12RB2
• Host Species: Mouse
• Immunogen: IL12RB2 (NP_001550, 105 a.a. ∽ 214 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3595
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only