IL4R, Mouse, Clone: 1D3, Abnova™

Catalog No.	Quantity
89-104-739	200 μL

Catalog No. 89-104-739 Supplier Abnova Corporation Supplier No. H00003566M01A

Description

Mouse monoclonal antibody raised against a partial recombinant IL4R.

This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene. [provided by RefSeq

Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV

Specifications

• Antigen: IL4R
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IL4R.
• Formulation: ascites with no preservative
• Gene: IL4R
• Gene Accession No.: NM_000418
• Gene Alias: CD124/IL4RA
• Gene Symbols: IL4R
• Host Species: Mouse
• Immunogen: IL4R (NP_000409,26 a.a. ∽ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3566
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ