IL6ST, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-744	50 μL

Catalog No. 89-104-744 Supplier Abnova Corporation Supplier No. H00003572A01

Description

Mouse polyclonal antibody raised against a partial recombinant IL6ST.

The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS

Specifications

• Antigen: IL6ST
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant IL6ST.
• Formulation: 50% glycerol
• Gene: IL6ST
• Gene Accession No.: NM_002184
• Gene Alias: CD130/CDw130/GP130/GP130-RAPS/IL6R-beta
• Gene Symbols: IL6ST
• Host Species: Mouse
• Immunogen: IL6ST (NP_002175, 23 a.a. ∽ 122 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3572
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only