ILK, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-752	50 μL

Catalog No. 89-104-752 Supplier Abnova Corporation Supplier No. H00003611A01

Description

Mouse polyclonal antibody raised against a partial recombinant ILK.

Transduction of extracellular matrix signals through integrins influences intracellular and extracellular functions, and appears to require interaction of integrin cytoplasmic domains with cellular proteins. Integrin-linked kinase (ILK), interacts with the cytoplasmic domain of beta-1 integrin. This gene encodes a serine/threonine protein kinase with 4 ankyrin-like repeats, which associates with the cytoplasmic domain of beta integrins and acts as a proximal receptor kinase regulating integrin-mediated signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Specifications

• Antigen: ILK
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ILK.
• Formulation: 50% glycerol
• Gene: ILK
• Gene Accession No.: BC001554
• Gene Alias: DKFZp686F1765/P59
• Gene Symbols: ILK
• Host Species: Mouse
• Immunogen: ILK (AAH01554, 341 a.a. ∽ 452 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3611
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only