ING1, Mouse, Clone: 2F9, Abnova™

Catalog No.	Quantity
89-104-760	200 μL

Catalog No. 89-104-760 Supplier Abnova Corporation Supplier No. H00003621M05A

Description

Mouse monoclonal antibody raised against a partial recombinant ING1.

This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA

Specifications

• Antigen: ING1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ING1.
• Formulation: ascites with no preservative
• Gene: ING1
• Gene Accession No.: NM_198219.1
• Gene Alias: p24ING1c/p33/p33ING1/p33ING1b/p47/p47ING1a
• Gene Symbols: ING1
• Host Species: Mouse
• Immunogen: ING1 (NP_937862.1,41 a.a. ∽ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3621
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ