ING3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-977	50 μL

Catalog No. 89-106-977 Supplier Abnova Corporation Supplier No. H00054556A01

Description

Mouse polyclonal antibody raised against a partial recombinant ING3.

The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq

Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF

Specifications

• Antigen: ING3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ING3.
• Formulation: 50% glycerol
• Gene: ING3
• Gene Accession No.: NM_198267
• Gene Alias: Eaf4/FLJ20089/ING2/p47ING3
• Gene Symbols: ING3
• Host Species: Mouse
• Immunogen: ING3 (NP_938008, 1 a.a. ∽ 92 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54556
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only