Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107609

IQCF1, Mouse, Clone: 1H4, Abnova™

Catalog No. 89107609 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-609 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-609 Supplier Abnova Corporation Supplier No. H00132141M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant IQCF1.

Sequence: MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPENQKKLSDKDTVATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAFSRKEWAAVTLQSQARMWRIRRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQLHLQLEILLDSGPCIVTECIPFSIKE

Specifications

Antigen IQCF1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1H4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant IQCF1.
Formulation PBS with no preservative; pH 7.4
Gene IQCF1
Gene Accession No. NM_152397.1
Gene Alias FLJ27508/MGC39725
Gene Symbols IQCF1
Host Species Mouse
Immunogen IQCF1 (NP_689610.1,1 a.a. ∽ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 132141
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.