ITGA7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-780	50 μL

Catalog No. 89-104-780 Supplier Abnova Corporation Supplier No. H00003679A01

Description

Mouse polyclonal antibody raised against a partial recombinant ITGA7.

The protein encoded by this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. They mediate a wide spectrum of cell-cell and cell-matrix interactions, and thus play a role in cell migration, morphologic development, differentiation, and metastasis. This protein functions as a receptor for the basement membrane protein laminin-1. It is mainly expressed in skeletal and cardiac muscles and may be involved in differentiation and migration processes during myogenesis. Defects in this gene are associated with congenital myopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq

Sequence: SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ

Specifications

• Antigen: ITGA7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ITGA7.
• Formulation: 50% glycerol
• Gene: ITGA7
• Gene Accession No.: NM_002206
• Gene Alias: FLJ25220
• Gene Symbols: ITGA7
• Host Species: Mouse
• Immunogen: ITGA7 (NP_002197, 478 a.a. ∽ 577 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3679
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only