ITGB1BP1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-043	50 μL

Catalog No. 89-106-043 Supplier Abnova Corporation Supplier No. H00009270A01

Description

Mouse polyclonal antibody raised against a partial recombinant ITGB1BP1.

The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion. [provided by RefSeq

Sequence: LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

Specifications

• Antigen: ITGB1BP1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ITGB1BP1.
• Formulation: 50% glycerol
• Gene: ITGB1BP1
• Gene Accession No.: BC012264
• Gene Alias: DKFZp686K08158/ICAP-1A/ICAP-1B/ICAP-1alpha/ICAP1/ICAP1A/ICAP1B
• Gene Symbols: ITGB1BP1
• Host Species: Mouse
• Immunogen: ITGB1BP1 (AAH12264, 101 a.a. ∽ 200 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9270
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only