KCNE2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-189	50 μL

Catalog No. 89-106-189 Supplier Abnova Corporation Supplier No. H00009992A01

Description

Mouse polyclonal antibody raised against a partial recombinant KCNE2.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq

Sequence: KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Specifications

• Antigen: KCNE2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant KCNE2.
• Formulation: 50% glycerol
• Gene: KCNE2
• Gene Accession No.: NM_172201
• Gene Alias: LQT5/LQT6/MGC138292/MIRP1
• Gene Symbols: KCNE2
• Host Species: Mouse
• Immunogen: KCNE2 (NP_751951, 73 a.a. ∽ 123 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9992
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only