Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106740

KCNMB3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89106740 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-740 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-740 Supplier Abnova Corporation Supplier No. H00027094A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant KCNMB3.

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22. [provided by RefSeq

Sequence: FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG

Specifications

Antigen KCNMB3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant KCNMB3.
Formulation 50% glycerol
Gene KCNMB3
Gene Accession No. NM_171828
Gene Alias KCNMB2/KCNMBL
Gene Symbols KCNMB3
Host Species Mouse
Immunogen KCNMB3 (NP_741979, 82 a.a. ∽ 181 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27094
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.