Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLF10, Mouse, Clone: 6E8, Abnova™

Catalog No. 89105607 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-607 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-607 Supplier Abnova Corporation Supplier No. H00007071M64
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant KLF10.

Sequence: LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD

Specifications

Antigen KLF10
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6E8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant KLF10.
Formulation PBS with no preservative; pH 7.4
Gene KLF10
Gene Accession No. BC011538.1
Gene Alias EGRA/TIEG/TIEG1
Gene Symbols KLF10
Host Species Mouse
Immunogen KLF10 (AAH11538.1,111 a.a. ∽ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A Purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7071
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.