Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLF10 (M65J), Mouse anti-Human, Clone: 7C1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant KLF10.

Manufacturer:  Abnova Corporation H00007071M65J

Catalog No. 89-105-609


Add to cart

Description

Description

Sequence: LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
Specifications

Specifications

KLF10
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
BC011538.1
EGRA/TIEG/TIEG1
Mouse
IgG2a Kappa
100 μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
7071
ELISA, Western Blot
7C1
Mouse monoclonal antibody raised against a partial recombinant KLF10.
KLF10
Liquid
KLF10
KLF10 (AAH11538.1,111 a.a. ∽ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Affinity chromatography
RUO
Antibody
Monoclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit