KLRB1, Mouse, Clone: 2F3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant KLRB1.

Supplier:  Abnova Corporation H00003820M01J

Catalog No. 89-104-813

Description

Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein is classified as a type II membrane protein because it has an external C terminus. [provided by RefSeq

Sequence: ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS

Specifications

• Antigen: KLRB1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002258
• Gene Symbols: KLRB1
• Immunogen: KLRB1 (NP_002249,126 a.a. ∽ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 2F3
• Description: Mouse monoclonal antibody raised against a full length recombinant KLRB1.
• Gene: KLRB1
• Gene Alias: CD161/CLEC5B/MGC138614/NKR/NKR-P1/NKR-P1A/NKRP1A/hNKR-P1A
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 3820
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid