KLRG1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant KLRG1.

Supplier:  Abnova Corporation H00010219A01

Catalog No. 89-106-250

Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. Alternatively spliced transcript variants have been reported, but their full-length natures have not yet been determined. [provided by RefSeq

Sequence: QWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEM

Specifications

• Antigen: KLRG1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant KLRG1.
• Gene: KLRG1
• Gene Alias: 2F1/CLEC15A/MAFA/MAFA-2F1/MAFA-L/MAFA-LIKE/MGC13600
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_005810
• Gene Symbols: KLRG1
• Immunogen: KLRG1 (NP_005801, 57 a.a. ∽ 119 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 10219
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only