LAMA3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-823	50 μL

Catalog No. 89-104-823 Supplier Abnova Corporation Supplier No. H00003909A01

Description

Mouse polyclonal antibody raised against a partial recombinant LAMA3.

Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: SSQQQRVPFLQPPGQSQLQASYVEFRPSQGCSPGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNSFATGCV

Specifications

• Antigen: LAMA3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LAMA3.
• Formulation: 50% glycerol
• Gene: LAMA3
• Gene Accession No.: NM_000227
• Gene Alias: BM600/E170/LAMNA/LOCS/lama3a
• Gene Symbols: LAMA3
• Host Species: Mouse
• Immunogen: LAMA3 (NP_000218, 29 a.a. ∽ 138 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3909
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only