LIFR, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-837	50 μL

Catalog No. 89-104-837 Supplier Abnova Corporation Supplier No. H00003977A01

Description

Mouse polyclonal antibody raised against a partial recombinant LIFR.

This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPEILNLSADFSTSTLY

Specifications

• Antigen: LIFR
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LIFR.
• Formulation: 50% glycerol
• Gene: LIFR
• Gene Accession No.: NM_002310
• Gene Alias: CD118/FLJ98106/FLJ99923/LIF-R/SJS2/STWS/SWS
• Gene Symbols: LIFR
• Host Species: Mouse
• Immunogen: LIFR (NP_002301, 45 a.a. ∽ 154 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3977
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only