LIG3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-839	50 μL

Catalog No. 89-104-839 Supplier Abnova Corporation Supplier No. H00003980A01

Description

Mouse polyclonal antibody raised against a partial recombinant LIG3.

This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: TKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC

Specifications

• Antigen: LIG3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant LIG3.
• Formulation: 50% glycerol
• Gene: LIG3
• Gene Accession No.: NM_013975
• Gene Alias: LIG2
• Gene Symbols: LIG3
• Host Species: Mouse
• Immunogen: LIG3 (NP_039269, 823 a.a. ∽ 922 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3980
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only