LIG4, Mouse, Clone: 1A4, Abnova™

Catalog No.	Quantity
89-104-840	200 μL

Catalog No. 89-104-840 Supplier Abnova Corporation Supplier No. H00003981M01A

Description

Mouse monoclonal antibody raised against a partial recombinant LIG4.

The protein encoded by this gene is a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq

Sequence: RYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI

Specifications

• Antigen: LIG4
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LIG4.
• Formulation: ascites with no preservative
• Gene: LIG4
• Gene Accession No.: BC037491
• Gene Symbols: LIG4
• Host Species: Mouse
• Immunogen: LIG4 (AAH37491,802 a.a. ∽ 911 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3981
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ