LRP1B, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LRP1B.

Supplier:  Abnova Corporation H00053353A01

Catalog No. 89-106-942

Description

LRP1B belongs to the low density lipoprotein (LDL) receptor gene family. These receptors play a wide variety of roles in normal cell function and development due to their interactions with multiple ligands (Liu et al., 2001 [PubMed 11384978]).[supplied by OMIM

Sequence: VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT

Specifications

• Antigen: LRP1B
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant LRP1B.
• Gene: LRP1B
• Gene Alias: LRP-DIT/LRPDIT
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_018557
• Gene Symbols: LRP1B
• Immunogen: LRP1B (NP_061027, 111 a.a. ∽ 200 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 53353
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only