LRRC29, Mouse, Clone: 4H7, Abnova™

Catalog No.	Quantity
89-106-690	200 μL

Catalog No. 89-106-690 Supplier Abnova Corporation Supplier No. H00026231M01A

Description

Mouse monoclonal antibody raised against a partial recombinant LRRC29.

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized. [provided by RefSeq]

Sequence: CPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL

Specifications

• Antigen: LRRC29
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4H7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant LRRC29.
• Formulation: ascites with no preservative
• Gene: LRRC29
• Gene Accession No.: NM_012163
• Gene Alias: FBL9/FBXL9
• Gene Symbols: LRRC29
• Host Species: Mouse
• Immunogen: LRRC29 (NP_036295,125 a.a. ∽ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26231
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ