LSM3, Mouse, Clone: 4H3, Abnova™

Catalog No.	Quantity
89-106-762	100 μg

Catalog No. 89-106-762 Supplier Abnova Corporation Supplier No. H00027258M08

Description

Mouse monoclonal antibody raised against a full-length recombinant LSM3.

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM

Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Specifications

• Antigen: LSM3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4H3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant LSM3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: LSM3
• Gene Accession No.: BC007055
• Gene Alias: SMX4/USS2/YLR438C
• Gene Symbols: LSM3
• Host Species: Mouse
• Immunogen: LSM3 (AAH07055,1 a.a. ∽ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 27258
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG2a κ