Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LSM3, Mouse, Clone: S1, Abnova™

Catalog No. 89106761 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-761 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-761 Supplier Abnova Corporation Supplier No. H00027258M01A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant LSM3.

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM

Sequence: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Specifications

Antigen LSM3
Applications ELISA, Western Blot
Classification Monoclonal
Clone S1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant LSM3.
Formulation ascites with no preservative
Gene LSM3
Gene Accession No. BC007055
Gene Alias SMX4/USS2/YLR438C
Gene Symbols LSM3
Host Species Mouse
Immunogen LSM3 (AAH07055,1 a.a. ∽ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27258
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.