Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104858

LY9, Mouse, Clone: 2F2, Abnova™

Catalog No. 89104858 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-858 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-858 Supplier Abnova Corporation Supplier No. H00004063M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant LY9.

LY9 belongs to the SLAM family of immunomodulatory receptors (see SLAMF1; MIM 603492) and interacts with the adaptor molecule SAP (SH2D1A; MIM 300490) (Graham et al., 2006 [PubMed 16365421]).[supplied by OMIM

Sequence: EPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTT

Specifications

Antigen LY9
Applications ELISA
Classification Monoclonal
Clone 2F2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant LY9.
Formulation ascites with no preservative
Gene LY9
Gene Accession No. NM_002348
Gene Alias CD229/SLAMF3/hly9/mLY9
Gene Symbols LY9
Host Species Mouse
Immunogen LY9 (NP_002339,156 a.a. ∽ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4063
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.