LYPLA1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LYPLA1.

Supplier:  Abnova Corporation H00010434A01

Catalog No. 89-106-314

Description

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq

Sequence: QQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID

Specifications

• Antigen: LYPLA1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant LYPLA1.
• Gene: LYPLA1
• Gene Alias: APT-1/LPL1/LYSOPLA
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006330
• Gene Symbols: LYPLA1
• Immunogen: LYPLA1 (NP_006321, 133 a.a. ∽ 230 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 10434
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only