MAGEA11, Mouse, Clone: 1C11, Abnova™

Catalog No.	Quantity
89-104-879	200 μL

Catalog No. 89-104-879 Supplier Abnova Corporation Supplier No. H00004110M02A

Description

Mouse monoclonal antibody raised against a full-length recombinant MAGEA11.

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV

Specifications

• Antigen: MAGEA11
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant MAGEA11.
• Formulation: ascites with no preservative
• Gene: MAGEA11
• Gene Accession No.: BC004479.1
• Gene Alias: MAGE-11/MAGE11/MAGEA-11/MGC10511
• Gene Symbols: MAGEA11
• Host Species: Mouse
• Immunogen: MAGEA11 (AAH04479.1,1 a.a. ∽ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4110
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ