MAP1LC3A, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MAP1LC3A.

Supplier:  Abnova Corporation H00084557A01

Catalog No. 89-107-455

Description

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE

Specifications

• Antigen: MAP1LC3A
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MAP1LC3A.
• Gene: MAP1LC3A
• Gene Alias: LC3/LC3A/MAP1ALC3/MAP1BLC3
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_032514
• Gene Symbols: MAP1LC3A
• Immunogen: MAP1LC3A (NP_115903, 1 a.a. ∽ 102 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 84557
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only