MAPK1, Mouse, Clone: 1D1, Abnova™

Catalog No.	Quantity
89-105-203	200 μL

Catalog No. 89-105-203 Supplier Abnova Corporation Supplier No. H00005594M01A

Description

Mouse monoclonal antibody raised against a partial recombinant MAPK1.

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq

Sequence: RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Specifications

• Antigen: MAPK1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPK1.
• Formulation: ascites with no preservative
• Gene: MAPK1
• Gene Accession No.: BC017832
• Gene Alias: ERK/ERK2/ERT1/MAPK2/P42MAPK/PRKM1/PRKM2/p38/p40/p41/p41mapk
• Gene Symbols: MAPK1
• Host Species: Mouse
• Immunogen: MAPK1 (AAH17832,261 a.a. ∽ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5594
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ