MAPK13, Mouse, Clone: 2B2, Abnova™

Catalog No.	Quantity
89-105-210	200 μL

Catalog No. 89-105-210 Supplier Abnova Corporation Supplier No. H00005603M05A

Description

Mouse monoclonal antibody raised against a partial recombinant MAPK13.

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. [provided by RefSeq

Sequence: NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

Specifications

• Antigen: MAPK13
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPK13.
• Formulation: ascites with no preservative
• Gene: MAPK13
• Gene Accession No.: BC000433
• Gene Alias: MGC99536/PRKM13/SAPK4/p38delta
• Gene Symbols: MAPK13
• Host Species: Mouse
• Immunogen: MAPK13 (AAH00433,251 a.a. ∽ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5603
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ