MAPRE1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-534	50 μL

Catalog No. 89-106-534 Supplier Abnova Corporation Supplier No. H00022919A01

Description

Mouse polyclonal antibody raised against a partial recombinant MAPRE1.

The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. [provided by RefSeq

Sequence: MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW

Specifications

• Antigen: MAPRE1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MAPRE1.
• Formulation: 50% glycerol
• Gene: MAPRE1
• Gene Accession No.: NM_012325
• Gene Alias: EB1/MGC117374/MGC129946
• Gene Symbols: MAPRE1
• Host Species: Mouse
• Immunogen: MAPRE1 (NP_036457, 1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 22919
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only