MATK, Mouse, Clone: 2C5, Abnova™

Catalog No.	Quantity
89-104-885	200 μL

Catalog No. 89-104-885 Supplier Abnova Corporation Supplier No. H00004145M05A

Description

Mouse monoclonal antibody raised against a partial recombinant MATK.

The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq

Sequence: RAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP

Specifications

• Antigen: MATK
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MATK.
• Formulation: ascites with no preservative
• Gene: MATK
• Gene Accession No.: NM_139355
• Gene Alias: CHK/CTK/DKFZp434N1212/HHYLTK/HYL/HYLTK/Lsk/MGC1708/MGC2101
• Gene Symbols: MATK
• Host Species: Mouse
• Immunogen: MATK (NP_647612,422 a.a. ∽ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4145
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ