MCM2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-895	50 μL

Catalog No. 89-104-895 Supplier Abnova Corporation Supplier No. H00004171A01

Description

Mouse polyclonal antibody raised against a partial recombinant MCM2.

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. [provided by RefSeq

Sequence: TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

Specifications

• Antigen: MCM2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MCM2.
• Formulation: 50% glycerol
• Gene: MCM2
• Gene Accession No.: BC007670
• Gene Alias: BM28/CCNL1/CDCL1/D3S3194/KIAA0030/MGC10606/MITOTIN/cdc19
• Gene Symbols: MCM2
• Host Species: Mouse
• Immunogen: MCM2 (AAH07670, 805 a.a. ∽ 904 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4171
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only