MCM3, Mouse, Clone: 4F7, Abnova™

Catalog No.	Quantity
89-104-896	200 μL

Catalog No. 89-104-896 Supplier Abnova Corporation Supplier No. H00004172M01A

Description

Mouse monoclonal antibody raised against a partial recombinant MCM3.

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq

Sequence: AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI

Specifications

• Antigen: MCM3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MCM3.
• Formulation: ascites with no preservative
• Gene: MCM3
• Gene Accession No.: NM_002388
• Gene Alias: HCC5/MGC1157/P1-MCM3/P1.h/RLFB
• Gene Symbols: MCM3
• Host Species: Mouse
• Immunogen: MCM3 (NP_002379,699 a.a. ∽ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4172
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a λ