MED17 (CRSP6), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-081	50 μL

Catalog No. 89-106-081 Supplier Abnova Corporation Supplier No. H00009440A01

Description

Mouse polyclonal antibody raised against a partial recombinant CRSP6.

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq

Sequence: FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL

Specifications

• Antigen: MED17 (CRSP6)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CRSP6.
• Formulation: 50% glycerol
• Gene: MED17
• Gene Accession No.: BC021101
• Gene Alias: CRSP6/CRSP77/DRIP80/FLJ10812/TRAP80
• Gene Symbols: MED17
• Host Species: Mouse
• Immunogen: CRSP6 (AAH21101, 551 a.a. ∽ 651 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9440
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only