Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104916

MEOX1 (M04), Mouse anti-Human, Clone: 1D10, Abnova™

Catalog No. 89104916 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-916 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-916 Supplier Abnova Corporation Supplier No. H00004222M04C
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant MEOX1.

This gene encodes a member of a subfamily of nonclustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

Sequence: PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS

Specifications

Antigen MEOX1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MEOX1.
Formulation tissue culture supernatant with no preservative
Gene MEOX1
Gene Accession No. NM_004527
Gene Alias MOX1
Gene Symbols MEOX1
Host Species Mouse
Immunogen MEOX1 (NP_004518.1,165 a.a. ∽ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4222
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.