MGAT1, Mouse, Clone: 2G4, Abnova™

Catalog No.	Quantity
89-104-920	200 μL

Catalog No. 89-104-920 Supplier Abnova Corporation Supplier No. H00004245M08A

Description

Mouse monoclonal antibody raised against a partial recombinant MGAT1.

There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. UDP-N-acetylglucosamine:alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I is a medial-Golgi enzyme essential for the synthesis of hybrid and complex N-glycans. The protein, encoded by a single exon, shows typical features of a type II transmembrane protein. The protein is believed to be essential for normal embryogenesis. Several variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPLTWEGYDPSWN

Specifications

• Antigen: MGAT1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2G4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MGAT1.
• Formulation: ascites with no preservative
• Gene: MGAT1
• Gene Accession No.: NM_002406
• Gene Alias: GLCNAC-TI/GLCT1/GLYT1/GNT-1/GNT-I/MGAT
• Gene Symbols: MGAT1
• Host Species: Mouse
• Immunogen: MGAT1 (NP_002397,348 a.a. ∽ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4245
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ