MMP26, Mouse, Clone: 3B9, Abnova™

Catalog No.	Quantity
89-107-136	200 μL

Catalog No. 89-107-136 Supplier Abnova Corporation Supplier No. H00056547M02A

Description

Mouse monoclonal antibody raised against a partial recombinant MMP26.

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. [provided by RefSeq

Sequence: SFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

Specifications

• Antigen: MMP26
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MMP26.
• Formulation: ascites with no preservative
• Gene: MMP26
• Gene Accession No.: NM_021801
• Gene Alias: MGC126590/MGC126592
• Gene Symbols: MMP26
• Host Species: Mouse
• Immunogen: MMP26 (NP_068573,152 a.a. ∽ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 56547
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ