MMP7, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MMP7.

Supplier:  Abnova Corporation H00004316A01

Catalog No. 89-104-933

Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq

Sequence: YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSL

Specifications

• Antigen: MMP7
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MMP7.
• Gene: MMP7
• Gene Alias: MMP-7/MPSL1/PUMP-1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_002423
• Gene Symbols: MMP7
• Immunogen: MMP7 (NP_002414, 95 a.a. ∽ 204 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 4316
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only