MMP7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-933	50 μL

Catalog No. 89-104-933 Supplier Abnova Corporation Supplier No. H00004316A01

Description

Mouse polyclonal antibody raised against a partial recombinant MMP7.

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq

Sequence: YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSL

Specifications

• Antigen: MMP7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MMP7.
• Formulation: 50% glycerol
• Gene: MMP7
• Gene Accession No.: NM_002423
• Gene Alias: MMP-7/MPSL1/PUMP-1
• Gene Symbols: MMP7
• Host Species: Mouse
• Immunogen: MMP7 (NP_002414, 95 a.a. ∽ 204 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4316
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only