MPP5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-279	50 μL

Catalog No. 89-107-279 Supplier Abnova Corporation Supplier No. H00064398A01

Description

Mouse polyclonal antibody raised against a partial recombinant MPP5.

Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains (Tseng et al., 2001 [PubMed 11311936]). MPP5 is a member of the p55-like MAGUK subfamily.[supplied by OMIM

Sequence: LDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS

Specifications

• Antigen: MPP5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MPP5.
• Formulation: 50% glycerol
• Gene: MPP5
• Gene Accession No.: NM_022474
• Gene Alias: FLJ12615/PALS1
• Gene Symbols: MPP5
• Host Species: Mouse
• Immunogen: MPP5 (NP_071919, 79 a.a. ∽ 177 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 64398
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only