MRPL49, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-185	50 μL

Catalog No. 89-104-185 Supplier Abnova Corporation Supplier No. H00000740A01

Description

Mouse polyclonal antibody raised against a partial recombinant MRPL49.

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for the HRD1 protein use in their respective 3' UTRs some of the same genomic sequence. Pseudogenes corresponding to this gene are found on chromosomes 5q and 8p. [provided by RefSeq]

Sequence: PTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF

Specifications

• Antigen: MRPL49
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MRPL49.
• Formulation: 50% glycerol
• Gene: MRPL49
• Gene Accession No.: NM_004927
• Gene Alias: C11orf4/L49mt/MGC10656/NOF/NOF1
• Gene Symbols: MRPL49
• Host Species: Mouse
• Immunogen: MRPL49 (NP_004918, 67 a.a. ∽ 166 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 740
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only