MSMB, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-944	50 μL

Catalog No. 89-104-944 Supplier Abnova Corporation Supplier No. H00004477A01

Description

Mouse polyclonal antibody raised against a full-length recombinant MSMB.

The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq

Sequence: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Specifications

• Antigen: MSMB
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length recombinant MSMB.
• Formulation: 50% glycerol
• Gene: MSMB
• Gene Accession No.: BC005257
• Gene Alias: HPC13/IGBF/MSP/MSPB/PN44/PRPS/PSP/PSP-94/PSP57/PSP94
• Gene Symbols: MSMB
• Host Species: Mouse
• Immunogen: MSMB (AAH05257.1, 1 a.a. ∽ 114 a.a) full-length recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4477
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only