Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106975

MTMR12, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89106975 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-975 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-975 Supplier Abnova Corporation Supplier No. H00054545A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant MTMR12.

Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes. The protein encoded by this gene functions as an adaptor subunit in a complex with an active PtdIns(3)P 3-phosphatase. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq

Sequence: PEAQILGGGQVATLSKLLEMMEEVQSLQEKIDERHHSQQAPQAEAPCLLRNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV

Specifications

Antigen MTMR12
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant MTMR12.
Formulation 50% glycerol
Gene MTMR12
Gene Accession No. NM_019061
Gene Alias 3-PAP/PIP3AP
Gene Symbols MTMR12
Host Species Mouse
Immunogen MTMR12 (NP_061934, 648 a.a. ∽ 747 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54545
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.